Hyaena hyaena (striped hyena): 120233111 Help Entry 120233111         CDS       T07257                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04024   cAMP signaling pathway hhv04080   Neuroactive ligand-receptor interaction hhv04081   Hormone signaling hhv04935   Growth hormone synthesis, secretion and action hhv04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     120233111 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     120233111 (SST)    04081 Hormone signaling     120233111 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     120233111 (SST)   09154 Digestive system    04971 Gastric acid secretion     120233111 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120233111 (SST) Cytokines and neuropeptides [BR:hhv04052]  Neuropeptides   GPCR binding    120233111 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  120233111 NCBI-ProteinID:  XP_039090162 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcttgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcaccggcgcgccctccgatccccggctccgccagtttctgcagaagtccctggcc gctgccgcggggaagcaggaactggccaagtacttcttggcggagctgctgtctgaaccc aaccagacagagaacgatgccctggaacctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggaactgcagagatctaccaactcaaaccctgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system