Hyaena hyaena (striped hyena): 120234136 Help Entry 120234136         CDS       T07257                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04613   Neutrophil extracellular trap formation hhv05034   Alcoholism hhv05202   Transcriptional misregulation in cancer hhv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hhv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120234136  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     120234136   09163 Immune disease    05322 Systemic lupus erythematosus     120234136   09165 Substance dependence    05034 Alcoholism     120234136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhv03036]     120234136   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120234136 Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120234136 Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120234136 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  120234136 NCBI-ProteinID:  XP_039091732 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagactgcccgcaaatccaccgggggtaaagcaccgaggaagcaa ctggccacaaaagccgctcgcaagagtgcgccctctaccggaggggtgaagaagcctcac cgctacaggcctggcaccgtggcactccgtgaaatcagacgttatcagaagtccactgaa cttctgatccgcaaactccctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagcgcggccatcggtgctttgcaggaggccagcgaggcctac ctggtgggcctttttgaagacaccaacctgtgcgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcgcgccgcatacgtggagagcgcgcctaa

DBGET integrated database retrieval system