Hyaena hyaena (striped hyena): 120235845 Help Entry 120235845         CDS       T07257                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04015   Rap1 signaling pathway hhv04810   Regulation of actin cytoskeleton hhv05014   Amyotrophic lateral sclerosis hhv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     120235845 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120235845 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120235845 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120235845 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120235845 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hhv04812]     120235845 (PFN4)    04147 Exosome [BR:hhv04147]     120235845 (PFN4) Membrane trafficking [BR:hhv04131]  Others   Actin-binding proteins    Others     120235845 (PFN4) Cytoskeleton proteins [BR:hhv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      120235845 (PFN4) Exosome [BR:hhv04147]  Exosomal proteins   Proteins found in most exosomes    120235845 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  120235845 NCBI-ProteinID:  XP_039094296 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcacctggatttagcgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggattgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaaaacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacggagaaactg ggagactatctaagaagaaagggaaattaa

DBGET integrated database retrieval system