Hyaena hyaena (striped hyena): 120235868 Help Entry 120235868         CDS       T07257                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04066   HIF-1 signaling pathway hhv04120   Ubiquitin mediated proteolysis hhv05170   Human immunodeficiency virus 1 infection hhv05200   Pathways in cancer hhv05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:hhv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120235868 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     120235868 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120235868 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     120235868 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120235868 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hhv04121]     120235868 (ELOC)    03400 DNA repair and recombination proteins [BR:hhv03400]     120235868 (ELOC) Ubiquitin system [BR:hhv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      120235868 (ELOC)    Cul5 complex      120235868 (ELOC) DNA repair and recombination proteins [BR:hhv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120235868 (ELOC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  120235868 NCBI-ProteinID:  XP_039094328 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacctatggtggctgtgaaggccctgatgccatgtatgtcaag ttgatatcttcggatggtcatgaatttattgtaaaaagagaacatgcactaacatccgga acaataaaagccatgttgagtggcccaggtcagtttgctgagaatgaaactaatgaagtc aattttagagagatcccttcacatgtgctatcaaaagtatgcatgtattttacctacaag gttcgctacactaacagctccacagagattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system