Hyaena hyaena (striped hyena): 120236651 Help Entry 120236651         CDS       T07257                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04010   MAPK signaling pathway hhv04020   Calcium signaling pathway hhv04022   cGMP-PKG signaling pathway hhv04114   Oocyte meiosis hhv04218   Cellular senescence hhv04310   Wnt signaling pathway hhv04360   Axon guidance hhv04370   VEGF signaling pathway hhv04380   Osteoclast differentiation hhv04625   C-type lectin receptor signaling pathway hhv04650   Natural killer cell mediated cytotoxicity hhv04658   Th1 and Th2 cell differentiation hhv04659   Th17 cell differentiation hhv04660   T cell receptor signaling pathway hhv04662   B cell receptor signaling pathway hhv04720   Long-term potentiation hhv04724   Glutamatergic synapse hhv04921   Oxytocin signaling pathway hhv04922   Glucagon signaling pathway hhv04924   Renin secretion hhv05010   Alzheimer disease hhv05014   Amyotrophic lateral sclerosis hhv05020   Prion disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05031   Amphetamine addiction hhv05152   Tuberculosis hhv05163   Human cytomegalovirus infection hhv05166   Human T-cell leukemia virus 1 infection hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05170   Human immunodeficiency virus 1 infection hhv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120236651 (PPP3R1)    04310 Wnt signaling pathway     120236651 (PPP3R1)    04370 VEGF signaling pathway     120236651 (PPP3R1)    04020 Calcium signaling pathway     120236651 (PPP3R1)    04022 cGMP-PKG signaling pathway     120236651 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120236651 (PPP3R1)    04218 Cellular senescence     120236651 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120236651 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     120236651 (PPP3R1)    04660 T cell receptor signaling pathway     120236651 (PPP3R1)    04658 Th1 and Th2 cell differentiation     120236651 (PPP3R1)    04659 Th17 cell differentiation     120236651 (PPP3R1)    04662 B cell receptor signaling pathway     120236651 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     120236651 (PPP3R1)    04921 Oxytocin signaling pathway     120236651 (PPP3R1)    04924 Renin secretion     120236651 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     120236651 (PPP3R1)    04720 Long-term potentiation     120236651 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     120236651 (PPP3R1)    04380 Osteoclast differentiation     120236651 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120236651 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120236651 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     120236651 (PPP3R1)    05163 Human cytomegalovirus infection     120236651 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     120236651 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     120236651 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     120236651 (PPP3R1)    05014 Amyotrophic lateral sclerosis     120236651 (PPP3R1)    05020 Prion disease     120236651 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     120236651 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     120236651 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120236651 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hhv01009]     120236651 (PPP3R1) Protein phosphatases and associated proteins [BR:hhv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120236651 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  120236651 NCBI-ProteinID:  XP_039095503 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttccttgagtgtg gaagaattcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat atatttgacacagatgggaatggagaagtagactttaaagaatttattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca gataaggatggagacggaagaatatcctttgaagaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system