Hyaena hyaena (striped hyena): 120236670 Help Entry 120236670         CDS       T07257                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04621   NOD-like receptor signaling pathway hhv05012   Parkinson disease hhv05132   Salmonella infection hhv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120236670 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120236670 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     120236670 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     120236670 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hhv03110]     120236670 (TXN) Chaperones and folding catalysts [BR:hhv03110]  Protein folding catalysts   Protein disulfide isomerase    120236670 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin DUF6568 Motif Other DBs NCBI-GeneID:  120236670 NCBI-ProteinID:  XP_039095540 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIENKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagaacaagtatgcttttcaggaagccttgaacagtgcaggggaa aaacttgtagtagtcgacttctctgccacgtggtgtggaccttgcaagatgatcaagccc ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggacgttgcttcagaatgtgaagtcaagtgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagctacc atcaatgagttaatctaa

DBGET integrated database retrieval system