Hyaena hyaena (striped hyena): 120236804 Help Entry 120236804         CDS       T07257                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04015   Rap1 signaling pathway hhv04810   Regulation of actin cytoskeleton hhv05014   Amyotrophic lateral sclerosis hhv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     120236804 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120236804 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120236804 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120236804 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120236804 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hhv04812]     120236804 (PFN3)    04147 Exosome [BR:hhv04147]     120236804 (PFN3) Membrane trafficking [BR:hhv04131]  Others   Actin-binding proteins    Others     120236804 (PFN3) Cytoskeleton proteins [BR:hhv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      120236804 (PFN3) Exosome [BR:hhv04147]  Exosomal proteins   Proteins found in most exosomes    120236804 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  120236804 NCBI-ProteinID:  XP_039095748 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QTGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTVHELTNGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaggctatatcagtgcggtgctgcgggaccagcgtattgatgacgtg gccattgtgggccactcggacaatcgttgcgtgtgggcatcgcgccctgggggccttcta gctgccatatcaccacaggaggtgggtgtgctcacagggcctgaccggcgcaccttcctg cagacgggcttgagtgtggcaggccgccgctgctgcgtcatccgagaccacctgctgtct gagggagatggtgttctggacgctcgcactaaggggctagatgggcgcgccatctgtgtg ggccacaccccacgcgcgctcctggtgctcatgggccgccggggtgtgcacgggggcatc ctcaacaagacagtgcacgaactgactaatgggttacgcaagcagggcacatag

DBGET integrated database retrieval system