Hyaena hyaena (striped hyena): 120236951 Help Entry 120236951         CDS       T07257                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv00190   Oxidative phosphorylation hhv01100   Metabolic pathways hhv01524   Platinum drug resistance hhv04115   p53 signaling pathway hhv04210   Apoptosis hhv04215   Apoptosis - multiple species hhv04932   Non-alcoholic fatty liver disease hhv05010   Alzheimer disease hhv05012   Parkinson disease hhv05014   Amyotrophic lateral sclerosis hhv05016   Huntington disease hhv05017   Spinocerebellar ataxia hhv05020   Prion disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05132   Salmonella infection hhv05134   Legionellosis hhv05145   Toxoplasmosis hhv05152   Tuberculosis hhv05160   Hepatitis C hhv05161   Hepatitis B hhv05162   Measles hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05168   Herpes simplex virus 1 infection hhv05169   Epstein-Barr virus infection hhv05170   Human immunodeficiency virus 1 infection hhv05200   Pathways in cancer hhv05210   Colorectal cancer hhv05222   Small cell lung cancer hhv05416   Viral myocarditis hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     120236951  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120236951    04215 Apoptosis - multiple species     120236951    04115 p53 signaling pathway     120236951  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120236951   09162 Cancer: specific types    05210 Colorectal cancer     120236951    05222 Small cell lung cancer     120236951   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120236951    05161 Hepatitis B     120236951    05160 Hepatitis C     120236951    05164 Influenza A     120236951    05162 Measles     120236951    05168 Herpes simplex virus 1 infection     120236951    05163 Human cytomegalovirus infection     120236951    05167 Kaposi sarcoma-associated herpesvirus infection     120236951    05169 Epstein-Barr virus infection     120236951   09171 Infectious disease: bacterial    05132 Salmonella infection     120236951    05134 Legionellosis     120236951    05152 Tuberculosis     120236951   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120236951   09164 Neurodegenerative disease    05010 Alzheimer disease     120236951    05012 Parkinson disease     120236951    05014 Amyotrophic lateral sclerosis     120236951    05016 Huntington disease     120236951    05017 Spinocerebellar ataxia     120236951    05020 Prion disease     120236951    05022 Pathways of neurodegeneration - multiple diseases     120236951   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120236951    05416 Viral myocarditis     120236951   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     120236951   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     120236951 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  120236951 NCBI-ProteinID:  XP_039095989 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MKKVERAGRPAWERAPSLRARPKSDLKMGDVEKGRKIFVQKCAQCHTVEKGGKHKTGPNL HGLFGQKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGVKKAGERA DLIVYLKKATKE NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaagaaagtggagagagctggacgtccggcttgggagcgggcaccttcgcttcgcgcg cgaccaaagagcgatttaaaaatgggtgatgttgagaaaggcaggaagatttttgttcag aagtgtgcccagtgccataccgtggaaaagggaggcaaacacaagacggggccaaatctc catggtttatttgggcaaaaaacgggtcaagcccctggattttcttacacggatgccaac aagaacaaaggcatcacctggggagaggagacactgatggagtatttggagaatcccaag aagtacatcccaggaacaaaaatgatcttcgctggcgttaagaaggcaggggaaagagca gacttgatagtttatctcaaaaaagctactaaggagtaa

DBGET integrated database retrieval system