KEGG   Hyaena hyaena (striped hyena): 120237182
Entry
120237182         CDS       T07257                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
hhv  Hyaena hyaena (striped hyena)
Pathway
hhv04014  Ras signaling pathway
hhv04015  Rap1 signaling pathway
hhv04020  Calcium signaling pathway
hhv04022  cGMP-PKG signaling pathway
hhv04024  cAMP signaling pathway
hhv04070  Phosphatidylinositol signaling system
hhv04114  Oocyte meiosis
hhv04218  Cellular senescence
hhv04261  Adrenergic signaling in cardiomyocytes
hhv04270  Vascular smooth muscle contraction
hhv04371  Apelin signaling pathway
hhv04625  C-type lectin receptor signaling pathway
hhv04713  Circadian entrainment
hhv04720  Long-term potentiation
hhv04722  Neurotrophin signaling pathway
hhv04728  Dopaminergic synapse
hhv04740  Olfactory transduction
hhv04744  Phototransduction
hhv04750  Inflammatory mediator regulation of TRP channels
hhv04910  Insulin signaling pathway
hhv04912  GnRH signaling pathway
hhv04915  Estrogen signaling pathway
hhv04916  Melanogenesis
hhv04921  Oxytocin signaling pathway
hhv04922  Glucagon signaling pathway
hhv04924  Renin secretion
hhv04925  Aldosterone synthesis and secretion
hhv04970  Salivary secretion
hhv04971  Gastric acid secretion
hhv05010  Alzheimer disease
hhv05012  Parkinson disease
hhv05022  Pathways of neurodegeneration - multiple diseases
hhv05031  Amphetamine addiction
hhv05034  Alcoholism
hhv05133  Pertussis
hhv05152  Tuberculosis
hhv05163  Human cytomegalovirus infection
hhv05167  Kaposi sarcoma-associated herpesvirus infection
hhv05170  Human immunodeficiency virus 1 infection
hhv05200  Pathways in cancer
hhv05214  Glioma
hhv05417  Lipid and atherosclerosis
hhv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hhv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    120237182
   04015 Rap1 signaling pathway
    120237182
   04371 Apelin signaling pathway
    120237182
   04020 Calcium signaling pathway
    120237182
   04070 Phosphatidylinositol signaling system
    120237182
   04024 cAMP signaling pathway
    120237182
   04022 cGMP-PKG signaling pathway
    120237182
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    120237182
   04218 Cellular senescence
    120237182
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    120237182
  09152 Endocrine system
   04910 Insulin signaling pathway
    120237182
   04922 Glucagon signaling pathway
    120237182
   04912 GnRH signaling pathway
    120237182
   04915 Estrogen signaling pathway
    120237182
   04921 Oxytocin signaling pathway
    120237182
   04916 Melanogenesis
    120237182
   04924 Renin secretion
    120237182
   04925 Aldosterone synthesis and secretion
    120237182
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    120237182
   04270 Vascular smooth muscle contraction
    120237182
  09154 Digestive system
   04970 Salivary secretion
    120237182
   04971 Gastric acid secretion
    120237182
  09156 Nervous system
   04728 Dopaminergic synapse
    120237182
   04720 Long-term potentiation
    120237182
   04722 Neurotrophin signaling pathway
    120237182
  09157 Sensory system
   04744 Phototransduction
    120237182
   04740 Olfactory transduction
    120237182
   04750 Inflammatory mediator regulation of TRP channels
    120237182
  09159 Environmental adaptation
   04713 Circadian entrainment
    120237182
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    120237182
  09162 Cancer: specific types
   05214 Glioma
    120237182
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    120237182
   05163 Human cytomegalovirus infection
    120237182
   05167 Kaposi sarcoma-associated herpesvirus infection
    120237182
  09171 Infectious disease: bacterial
   05133 Pertussis
    120237182
   05152 Tuberculosis
    120237182
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    120237182
   05012 Parkinson disease
    120237182
   05022 Pathways of neurodegeneration - multiple diseases
    120237182
  09165 Substance dependence
   05031 Amphetamine addiction
    120237182
   05034 Alcoholism
    120237182
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    120237182
   05418 Fluid shear stress and atherosclerosis
    120237182
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hhv01009]
    120237182
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hhv04131]
    120237182
   03036 Chromosome and associated proteins [BR:hhv03036]
    120237182
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhv04147]
    120237182
Protein phosphatases and associated proteins [BR:hhv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     120237182
Membrane trafficking [BR:hhv04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    120237182
Chromosome and associated proteins [BR:hhv03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     120237182
Exosome [BR:hhv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   120237182
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C Dockerin_1 FCaBP_EF-hand Adenine_glyco UPF0154 TerB SurA_N_2 T2SSK SurA_N_3 RNA_pol_Rpb4 DUF1707 DUF2267 DUF533 DUF3008 Tsc35
Other DBs
NCBI-GeneID: 120237182
NCBI-ProteinID: XP_039096287
LinkDB
Position
Unknown
AA seq 149 aa
MAEQLSKEQVDEFRAAFAQFDRNGDGKINTEELGAVMEALGEKLSEDELKAIIARVDTDG
DGVISFPEFLAEMAKRTKDWGSEAEMREVFRAFDLDGDGRISVDELEQAMAKMGESASRE
ELDAMIQGADADQDGQVNFEEFRRILSQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgagcagctgtctaaagagcaggtggatgaattcagggcggccttcgcccagttt
gaccggaacggggacggaaagatcaacacggaggagctgggcgccgtgatggaggccctg
ggcgagaagctgtcggaagacgagctgaaggccatcatcgccagggtggacaccgacggc
gacggcgtcatcagcttcccagagttcctggcagagatggccaagaggacgaaggactgg
ggcagcgaggcggagatgcgggaggtcttccgggccttcgacctggatggcgacggccgc
atcagcgtggatgagctcgagcaggccatggccaagatgggcgagagcgcctcccgggag
gagctggacgccatgatccagggggccgacgcggaccaggacgggcaggtgaacttcgag
gagttcaggcgcatcctctctcagaagtga

DBGET integrated database retrieval system