Hyaena hyaena (striped hyena): 120237195 Help Entry 120237195         CDS       T07257                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04014   Ras signaling pathway hhv04015   Rap1 signaling pathway hhv04020   Calcium signaling pathway hhv04022   cGMP-PKG signaling pathway hhv04024   cAMP signaling pathway hhv04070   Phosphatidylinositol signaling system hhv04114   Oocyte meiosis hhv04218   Cellular senescence hhv04261   Adrenergic signaling in cardiomyocytes hhv04270   Vascular smooth muscle contraction hhv04371   Apelin signaling pathway hhv04625   C-type lectin receptor signaling pathway hhv04713   Circadian entrainment hhv04720   Long-term potentiation hhv04722   Neurotrophin signaling pathway hhv04728   Dopaminergic synapse hhv04740   Olfactory transduction hhv04744   Phototransduction hhv04750   Inflammatory mediator regulation of TRP channels hhv04910   Insulin signaling pathway hhv04912   GnRH signaling pathway hhv04915   Estrogen signaling pathway hhv04916   Melanogenesis hhv04921   Oxytocin signaling pathway hhv04922   Glucagon signaling pathway hhv04924   Renin secretion hhv04925   Aldosterone synthesis and secretion hhv04970   Salivary secretion hhv04971   Gastric acid secretion hhv05010   Alzheimer disease hhv05012   Parkinson disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05031   Amphetamine addiction hhv05034   Alcoholism hhv05133   Pertussis hhv05152   Tuberculosis hhv05163   Human cytomegalovirus infection hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05170   Human immunodeficiency virus 1 infection hhv05200   Pathways in cancer hhv05214   Glioma hhv05417   Lipid and atherosclerosis hhv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120237195    04015 Rap1 signaling pathway     120237195    04371 Apelin signaling pathway     120237195    04020 Calcium signaling pathway     120237195    04070 Phosphatidylinositol signaling system     120237195    04024 cAMP signaling pathway     120237195    04022 cGMP-PKG signaling pathway     120237195  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120237195    04218 Cellular senescence     120237195  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120237195   09152 Endocrine system    04910 Insulin signaling pathway     120237195    04922 Glucagon signaling pathway     120237195    04912 GnRH signaling pathway     120237195    04915 Estrogen signaling pathway     120237195    04921 Oxytocin signaling pathway     120237195    04916 Melanogenesis     120237195    04924 Renin secretion     120237195    04925 Aldosterone synthesis and secretion     120237195   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120237195    04270 Vascular smooth muscle contraction     120237195   09154 Digestive system    04970 Salivary secretion     120237195    04971 Gastric acid secretion     120237195   09156 Nervous system    04728 Dopaminergic synapse     120237195    04720 Long-term potentiation     120237195    04722 Neurotrophin signaling pathway     120237195   09157 Sensory system    04744 Phototransduction     120237195    04740 Olfactory transduction     120237195    04750 Inflammatory mediator regulation of TRP channels     120237195   09159 Environmental adaptation    04713 Circadian entrainment     120237195  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120237195   09162 Cancer: specific types    05214 Glioma     120237195   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120237195    05163 Human cytomegalovirus infection     120237195    05167 Kaposi sarcoma-associated herpesvirus infection     120237195   09171 Infectious disease: bacterial    05133 Pertussis     120237195    05152 Tuberculosis     120237195   09164 Neurodegenerative disease    05010 Alzheimer disease     120237195    05012 Parkinson disease     120237195    05022 Pathways of neurodegeneration - multiple diseases     120237195   09165 Substance dependence    05031 Amphetamine addiction     120237195    05034 Alcoholism     120237195   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120237195    05418 Fluid shear stress and atherosclerosis     120237195  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hhv01009]     120237195   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120237195    03036 Chromosome and associated proteins [BR:hhv03036]     120237195   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120237195 Protein phosphatases and associated proteins [BR:hhv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120237195 Membrane trafficking [BR:hhv04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120237195 Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120237195 Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120237195 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C UPF0154 SPARC_Ca_bdg EH EF_EFCAB10_C Temptin_C EF-hand_EFHB_C Caleosin EFhand_Ca_insen Dockerin_1 DUF5580_M EF-hand_11 SurA_N_3 EF-hand_SWAP70_N Motif Other DBs NCBI-GeneID:  120237195 NCBI-ProteinID:  XP_039096306 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDRDGNGLVSASELRHVMTRLGEKLSDD EVDEMIRAADGDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacggaggagcaggtggccgagttcagggaggccttctgcctgttc gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg ggccagaaccccacggaggccgagctgcgcgacatggtgggcgagatcgaccgcgacggg aacggctccgtggacttccccgagttcctgggcatgatggcccggcagctgaggggcagg gacagcgaggagcagatccgggaggccttccgcgtgttcgacagggacggcaacggcctg gtgagcgcctccgagctgcggcacgtgatgaccaggctgggggagaagctgagcgacgac gaggtggacgagatgatccgggccgccgacggggacggggacggccaggtcaactacgag gagttcgtgcacatgctggtgtccaagtga

DBGET integrated database retrieval system