Hyaena hyaena (striped hyena): 120238583 Help Entry 120238583         CDS       T07257                                  Name (RefSeq) claudin-6-like   KO K06087   claudin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv03272   Virion - Hepatitis viruses hhv04382   Cornified envelope formation hhv04514   Cell adhesion molecules hhv04530   Tight junction hhv04670   Leukocyte transendothelial migration hhv05160   Hepatitis C Brite KEGG Orthology (KO) [BR:hhv00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     120238583  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     120238583  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     120238583  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     120238583   09158 Development and regeneration    04382 Cornified envelope formation     120238583  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     120238583  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hhv03037]     120238583    04147 Exosome [BR:hhv04147]     120238583    04515 Cell adhesion molecules [BR:hhv04515]     120238583 Cilium and associated proteins [BR:hhv03037]  Other cilia and associated proteins   Stereociliary proteins    120238583 Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    120238583   Exosomal proteins of colorectal cancer cells    120238583 Cell adhesion molecules [BR:hhv04515]  Immunoglobulin superfamily   L1 family    120238583 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF5408 DUF3810 Motif Other DBs NCBI-GeneID:  120238583 NCBI-ProteinID:  XP_039098314 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MICIIMVAQVAQEGLWMSCMVQSTGQMQYKVYNSLLMLPQDLHTAIAFCIITLLLALLGL LVYLTRAKCTSCTEDKESKAHLMFFSGIIFVISRVLTLIPICWTAHTIIQDFYNLWVLKT QKPVLGTSSFGLLLPCLPL NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgatctgcatcatcatggtggcccaggtggcacaggaggggctgtggatgtcttgcatg gtgcaaagcacaggtcagatgcagtacaaagtgtataactcacttctaatgctgccccag gacctgcacactgccatcgccttttgcatcatcaccctcctgttggccctccttggtctg ctggtctacctcactagagccaagtgtaccagctgcacagaagacaaggaatccaaggcc catctgatgtttttctctgggatcatctttgtcatctcaagggtcctgaccctgatccct atctgctggacagcccacaccatcatccaggacttttacaacctgtgggtgctcaagacc caaaagccagtgctggggacctcctcctttggcctcttgttgccatgcctgcccctctag

DBGET integrated database retrieval system