KEGG   Hyaena hyaena (striped hyena): 120238830
Entry
120238830         CDS       T07257                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hhv  Hyaena hyaena (striped hyena)
Pathway
hhv01521  EGFR tyrosine kinase inhibitor resistance
hhv01522  Endocrine resistance
hhv01524  Platinum drug resistance
hhv04010  MAPK signaling pathway
hhv04012  ErbB signaling pathway
hhv04014  Ras signaling pathway
hhv04015  Rap1 signaling pathway
hhv04022  cGMP-PKG signaling pathway
hhv04024  cAMP signaling pathway
hhv04062  Chemokine signaling pathway
hhv04066  HIF-1 signaling pathway
hhv04068  FoxO signaling pathway
hhv04071  Sphingolipid signaling pathway
hhv04072  Phospholipase D signaling pathway
hhv04114  Oocyte meiosis
hhv04140  Autophagy - animal
hhv04148  Efferocytosis
hhv04150  mTOR signaling pathway
hhv04151  PI3K-Akt signaling pathway
hhv04210  Apoptosis
hhv04218  Cellular senescence
hhv04261  Adrenergic signaling in cardiomyocytes
hhv04270  Vascular smooth muscle contraction
hhv04350  TGF-beta signaling pathway
hhv04360  Axon guidance
hhv04370  VEGF signaling pathway
hhv04371  Apelin signaling pathway
hhv04380  Osteoclast differentiation
hhv04510  Focal adhesion
hhv04517  IgSF CAM signaling
hhv04520  Adherens junction
hhv04540  Gap junction
hhv04550  Signaling pathways regulating pluripotency of stem cells
hhv04611  Platelet activation
hhv04613  Neutrophil extracellular trap formation
hhv04620  Toll-like receptor signaling pathway
hhv04621  NOD-like receptor signaling pathway
hhv04625  C-type lectin receptor signaling pathway
hhv04650  Natural killer cell mediated cytotoxicity
hhv04657  IL-17 signaling pathway
hhv04658  Th1 and Th2 cell differentiation
hhv04659  Th17 cell differentiation
hhv04660  T cell receptor signaling pathway
hhv04662  B cell receptor signaling pathway
hhv04664  Fc epsilon RI signaling pathway
hhv04666  Fc gamma R-mediated phagocytosis
hhv04668  TNF signaling pathway
hhv04713  Circadian entrainment
hhv04720  Long-term potentiation
hhv04722  Neurotrophin signaling pathway
hhv04723  Retrograde endocannabinoid signaling
hhv04724  Glutamatergic synapse
hhv04725  Cholinergic synapse
hhv04726  Serotonergic synapse
hhv04730  Long-term depression
hhv04810  Regulation of actin cytoskeleton
hhv04910  Insulin signaling pathway
hhv04912  GnRH signaling pathway
hhv04914  Progesterone-mediated oocyte maturation
hhv04915  Estrogen signaling pathway
hhv04916  Melanogenesis
hhv04917  Prolactin signaling pathway
hhv04919  Thyroid hormone signaling pathway
hhv04921  Oxytocin signaling pathway
hhv04926  Relaxin signaling pathway
hhv04928  Parathyroid hormone synthesis, secretion and action
hhv04929  GnRH secretion
hhv04930  Type II diabetes mellitus
hhv04933  AGE-RAGE signaling pathway in diabetic complications
hhv04934  Cushing syndrome
hhv04935  Growth hormone synthesis, secretion and action
hhv04960  Aldosterone-regulated sodium reabsorption
hhv05010  Alzheimer disease
hhv05020  Prion disease
hhv05022  Pathways of neurodegeneration - multiple diseases
hhv05034  Alcoholism
hhv05132  Salmonella infection
hhv05133  Pertussis
hhv05135  Yersinia infection
hhv05140  Leishmaniasis
hhv05142  Chagas disease
hhv05145  Toxoplasmosis
hhv05152  Tuberculosis
hhv05160  Hepatitis C
hhv05161  Hepatitis B
hhv05163  Human cytomegalovirus infection
hhv05164  Influenza A
hhv05165  Human papillomavirus infection
hhv05166  Human T-cell leukemia virus 1 infection
hhv05167  Kaposi sarcoma-associated herpesvirus infection
hhv05170  Human immunodeficiency virus 1 infection
hhv05171  Coronavirus disease - COVID-19
hhv05200  Pathways in cancer
hhv05203  Viral carcinogenesis
hhv05205  Proteoglycans in cancer
hhv05206  MicroRNAs in cancer
hhv05207  Chemical carcinogenesis - receptor activation
hhv05208  Chemical carcinogenesis - reactive oxygen species
hhv05210  Colorectal cancer
hhv05211  Renal cell carcinoma
hhv05212  Pancreatic cancer
hhv05213  Endometrial cancer
hhv05214  Glioma
hhv05215  Prostate cancer
hhv05216  Thyroid cancer
hhv05218  Melanoma
hhv05219  Bladder cancer
hhv05220  Chronic myeloid leukemia
hhv05221  Acute myeloid leukemia
hhv05223  Non-small cell lung cancer
hhv05224  Breast cancer
hhv05225  Hepatocellular carcinoma
hhv05226  Gastric cancer
hhv05230  Central carbon metabolism in cancer
hhv05231  Choline metabolism in cancer
hhv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hhv05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hhv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    120238830 (MAPK1)
   04012 ErbB signaling pathway
    120238830 (MAPK1)
   04014 Ras signaling pathway
    120238830 (MAPK1)
   04015 Rap1 signaling pathway
    120238830 (MAPK1)
   04350 TGF-beta signaling pathway
    120238830 (MAPK1)
   04370 VEGF signaling pathway
    120238830 (MAPK1)
   04371 Apelin signaling pathway
    120238830 (MAPK1)
   04668 TNF signaling pathway
    120238830 (MAPK1)
   04066 HIF-1 signaling pathway
    120238830 (MAPK1)
   04068 FoxO signaling pathway
    120238830 (MAPK1)
   04072 Phospholipase D signaling pathway
    120238830 (MAPK1)
   04071 Sphingolipid signaling pathway
    120238830 (MAPK1)
   04024 cAMP signaling pathway
    120238830 (MAPK1)
   04022 cGMP-PKG signaling pathway
    120238830 (MAPK1)
   04151 PI3K-Akt signaling pathway
    120238830 (MAPK1)
   04150 mTOR signaling pathway
    120238830 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    120238830 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    120238830 (MAPK1)
   04148 Efferocytosis
    120238830 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    120238830 (MAPK1)
   04210 Apoptosis
    120238830 (MAPK1)
   04218 Cellular senescence
    120238830 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    120238830 (MAPK1)
   04520 Adherens junction
    120238830 (MAPK1)
   04540 Gap junction
    120238830 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    120238830 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    120238830 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    120238830 (MAPK1)
   04613 Neutrophil extracellular trap formation
    120238830 (MAPK1)
   04620 Toll-like receptor signaling pathway
    120238830 (MAPK1)
   04621 NOD-like receptor signaling pathway
    120238830 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    120238830 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    120238830 (MAPK1)
   04660 T cell receptor signaling pathway
    120238830 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    120238830 (MAPK1)
   04659 Th17 cell differentiation
    120238830 (MAPK1)
   04657 IL-17 signaling pathway
    120238830 (MAPK1)
   04662 B cell receptor signaling pathway
    120238830 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    120238830 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    120238830 (MAPK1)
   04062 Chemokine signaling pathway
    120238830 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    120238830 (MAPK1)
   04929 GnRH secretion
    120238830 (MAPK1)
   04912 GnRH signaling pathway
    120238830 (MAPK1)
   04915 Estrogen signaling pathway
    120238830 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    120238830 (MAPK1)
   04917 Prolactin signaling pathway
    120238830 (MAPK1)
   04921 Oxytocin signaling pathway
    120238830 (MAPK1)
   04926 Relaxin signaling pathway
    120238830 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    120238830 (MAPK1)
   04919 Thyroid hormone signaling pathway
    120238830 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    120238830 (MAPK1)
   04916 Melanogenesis
    120238830 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    120238830 (MAPK1)
   04270 Vascular smooth muscle contraction
    120238830 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    120238830 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    120238830 (MAPK1)
   04725 Cholinergic synapse
    120238830 (MAPK1)
   04726 Serotonergic synapse
    120238830 (MAPK1)
   04720 Long-term potentiation
    120238830 (MAPK1)
   04730 Long-term depression
    120238830 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    120238830 (MAPK1)
   04722 Neurotrophin signaling pathway
    120238830 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    120238830 (MAPK1)
   04380 Osteoclast differentiation
    120238830 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    120238830 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    120238830 (MAPK1)
   05206 MicroRNAs in cancer
    120238830 (MAPK1)
   05205 Proteoglycans in cancer
    120238830 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    120238830 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    120238830 (MAPK1)
   05203 Viral carcinogenesis
    120238830 (MAPK1)
   05230 Central carbon metabolism in cancer
    120238830 (MAPK1)
   05231 Choline metabolism in cancer
    120238830 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    120238830 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    120238830 (MAPK1)
   05212 Pancreatic cancer
    120238830 (MAPK1)
   05225 Hepatocellular carcinoma
    120238830 (MAPK1)
   05226 Gastric cancer
    120238830 (MAPK1)
   05214 Glioma
    120238830 (MAPK1)
   05216 Thyroid cancer
    120238830 (MAPK1)
   05221 Acute myeloid leukemia
    120238830 (MAPK1)
   05220 Chronic myeloid leukemia
    120238830 (MAPK1)
   05218 Melanoma
    120238830 (MAPK1)
   05211 Renal cell carcinoma
    120238830 (MAPK1)
   05219 Bladder cancer
    120238830 (MAPK1)
   05215 Prostate cancer
    120238830 (MAPK1)
   05213 Endometrial cancer
    120238830 (MAPK1)
   05224 Breast cancer
    120238830 (MAPK1)
   05223 Non-small cell lung cancer
    120238830 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    120238830 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    120238830 (MAPK1)
   05161 Hepatitis B
    120238830 (MAPK1)
   05160 Hepatitis C
    120238830 (MAPK1)
   05171 Coronavirus disease - COVID-19
    120238830 (MAPK1)
   05164 Influenza A
    120238830 (MAPK1)
   05163 Human cytomegalovirus infection
    120238830 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    120238830 (MAPK1)
   05165 Human papillomavirus infection
    120238830 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    120238830 (MAPK1)
   05135 Yersinia infection
    120238830 (MAPK1)
   05133 Pertussis
    120238830 (MAPK1)
   05152 Tuberculosis
    120238830 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    120238830 (MAPK1)
   05140 Leishmaniasis
    120238830 (MAPK1)
   05142 Chagas disease
    120238830 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    120238830 (MAPK1)
   05020 Prion disease
    120238830 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    120238830 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    120238830 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    120238830 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    120238830 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    120238830 (MAPK1)
   04934 Cushing syndrome
    120238830 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    120238830 (MAPK1)
   01524 Platinum drug resistance
    120238830 (MAPK1)
   01522 Endocrine resistance
    120238830 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hhv01001]
    120238830 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hhv03036]
    120238830 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhv04147]
    120238830 (MAPK1)
Enzymes [BR:hhv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     120238830 (MAPK1)
Protein kinases [BR:hhv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   120238830 (MAPK1)
Chromosome and associated proteins [BR:hhv03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     120238830 (MAPK1)
Exosome [BR:hhv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   120238830 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 120238830
NCBI-ProteinID: XP_039098791
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcagcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtgggaccgcgctacaccaacctctcttatatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacattattggaatcaatgatattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagccaatgtactacaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccggaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccgtcacaggaagacctgaactgcataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccatccatacctggagcagtattatgacccaagt
gatgagcccgttgctgaggcaccgttcaagttcgacatggagctggacgacctgcccaag
gaaaagctcaaagaactcatcttcgaagaaacggccaggttccagccgggatacaggtct
taa

DBGET integrated database retrieval system