Hyaena hyaena (striped hyena): 120239195 Help Entry 120239195         CDS       T07257                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04140   Autophagy - animal hhv04144   Endocytosis hhv04152   AMPK signaling pathway hhv04530   Tight junction hhv04972   Pancreatic secretion hhv05014   Amyotrophic lateral sclerosis hhv05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     120239195 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120239195 (RAB8A)    04140 Autophagy - animal     120239195 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     120239195 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     120239195 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120239195 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     120239195 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120239195 (RAB8A)    03036 Chromosome and associated proteins [BR:hhv03036]     120239195 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120239195 (RAB8A)    04031 GTP-binding proteins [BR:hhv04031]     120239195 (RAB8A) Membrane trafficking [BR:hhv04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     120239195 (RAB8A)  Autophagy   Other autophagy associated proteins     120239195 (RAB8A) Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120239195 (RAB8A) Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120239195 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    120239195 (RAB8A)   Exosomal proteins of colorectal cancer cells    120239195 (RAB8A) GTP-binding proteins [BR:hhv04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     120239195 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  120239195 NCBI-ProteinID:  XP_039099283 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSQGVKITPDPQRRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacaccgctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaatattgaggagcacgcctctgcagatgtcgaaaagatgatcctcgga aacaagtgtgacgtgaacgacaagagacaagtatccaaggaacggggagagaagctcgcc ctggattatggaatcaagttcatggagaccagtgcgaaggccaacatcaacgtggagaat gccttcttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agtccccaagggagcagccagggggtcaaaatcaccccggacccgcagcggaggagcagc tttttccgatgcgttcttctgtga

DBGET integrated database retrieval system