Hyaena hyaena (striped hyena): 120240784 Help Entry 120240784         CDS       T07257                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv03010   Ribosome hhv04120   Ubiquitin mediated proteolysis hhv04137   Mitophagy - animal hhv04140   Autophagy - animal hhv05012   Parkinson disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05171   Coronavirus disease Brite KEGG Orthology (KO) [BR:hhv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     120240784   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120240784  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120240784    04137 Mitophagy - animal     120240784  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     120240784    05167 Kaposi sarcoma-associated herpesvirus infection     120240784   09164 Neurodegenerative disease    05012 Parkinson disease     120240784    05022 Pathways of neurodegeneration - multiple diseases     120240784  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hhv03011]     120240784    04121 Ubiquitin system [BR:hhv04121]     120240784   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120240784 Ribosome [BR:hhv03011]  Ribosomal proteins   Eukaryotes    Small subunit     120240784   Archaea     120240784 Ubiquitin system [BR:hhv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    120240784 Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120240784   Exosomal proteins of colorectal cancer cells    120240784 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_S27 Ubiquitin_2 Rad60-SLD_2 Dsc3_N DUF2604 TBK1_ULD Ubiquitin_5 Motif Other DBs NCBI-GeneID:  120240784 NCBI-ProteinID:  XP_039101548 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MQIFVKTLTGKTITLEVEPLDTIENVKAKIQDKEGIPPDQQRLIFAGKKLEDGRTLSDYN IQKESTLHLVLRLHGGAKKRKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRQEC P NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcgtgaaaactcttacggggaagaccatcactcttgaggtcgaacccttg gatacaatagaaaatgtgaaggccaagattcaggataaggaaggaatccctcctgatcag cagagattgatttttgctggcaagaaactagaagatgggcgtactttgtctgactacaac attcaaaaggagtccactcttcatctggtgttgagacttcatggtggtgctaaaaaaagg aagaagtcttataccactcccaagaagaataagcataagagaaagaaggttaaactggca gtcctgaaatactataaggtggatgagaatggcaaaatcagtcgccttcgtcaggagtgc ccttaa

DBGET integrated database retrieval system