Hyaena hyaena (striped hyena): 120241140 Help Entry 120241140         CDS       T07257                                  Symbol DNAL4 Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04814   Motor proteins hhv05014   Amyotrophic lateral sclerosis hhv05016   Huntington disease hhv05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:hhv00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     120241140 (DNAL4)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120241140 (DNAL4)    05016 Huntington disease     120241140 (DNAL4)    05022 Pathways of neurodegeneration - multiple diseases     120241140 (DNAL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hhv03037]     120241140 (DNAL4)    04812 Cytoskeleton proteins [BR:hhv04812]     120241140 (DNAL4) Cilium and associated proteins [BR:hhv03037]  Motile cilia and associated proteins   Dynein arm    120241140 (DNAL4) Cytoskeleton proteins [BR:hhv04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120241140 (DNAL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  120241140 NCBI-ProteinID:  XP_039102000 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggagaaacagaagggaagaaagatgaggctgattataagcgactgcagaccttccct ctggtcaggcactcggacatgccagaggagatgcgagtggagaccatggagctgtgcgtc acggcctgtgagaaattctccaacaacaacgagagcgctgccaagatgatcaaagagaca atggacaagaagttcggctcctcctggcatgtggtcatcggcgagggctttgggtttgag atcacgcacgaggtgaagaacctcctatacctgtacttcggggggaccctggctgtgtgt gtctggaagtgctcctga

DBGET integrated database retrieval system