Hyaena hyaena (striped hyena): 120243133 Help Entry 120243133         CDS       T07257                                  Name (RefSeq) metallothionein-1F-like   KO K14739   metallothionein 1/2 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04978   Mineral absorption Brite KEGG Orthology (KO) [BR:hhv00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     120243133  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hhv03019]     120243133    03029 Mitochondrial biogenesis [BR:hhv03029]     120243133 Messenger RNA biogenesis [BR:hhv03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      120243133 Mitochondrial biogenesis [BR:hhv03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     120243133 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  120243133 NCBI-ProteinID:  XP_039105106 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCFCPTGDSCTHLGSCTCKVCKCTPCKESCCSHCPMGCAKYAQGCICRETADKCRCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgcttctgtcccaccggggactcctgcacccacctgggctcctgtaca tgtaaagtgtgcaaatgcaccccctgcaaggagagctgctgttcccactgccccatgggc tgtgccaagtatgcccagggctgcatctgccgggagacagctgataagtgccgctgctgt gcctga

DBGET integrated database retrieval system