Hyaena hyaena (striped hyena): 120244471 Help Entry 120244471         CDS       T07257                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism hhv  Hyaena hyaena (striped hyena) Brite KEGG Orthology (KO) [BR:hhv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:hhv03041]     120244471 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120244471 (UBL5) Spliceosome [BR:hhv03041]  Complex B   Other components    Complex B specific factors     120244471 (UBL5) Cytokines and neuropeptides [BR:hhv04052]  Neuropeptides   Unclassified    120244471 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  120244471 NCBI-ProteinID:  XP_039106956 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaggtccgcgttaagtgcaacact gatgacaccatcggggaccttaagaagctaatcgcagcccaaactggcacccgttggaac aagatcgtcctgaagaagtggtacacgatttttaaggaccatgtgtctctgggagactat gaaatccacgacgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system