Hyaena hyaena (striped hyena): 120248251 Help Entry 120248251         CDS       T07257                                  Name (RefSeq) histone H2A-beta, sperm-like   KO K11251   histone H2A Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv03082   ATP-dependent chromatin remodeling hhv04217   Necroptosis hhv04613   Neutrophil extracellular trap formation hhv05034   Alcoholism hhv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hhv00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120248251  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120248251  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120248251  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     120248251   09165 Substance dependence    05034 Alcoholism     120248251  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhv03036]     120248251   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120248251 Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120248251 Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120248251 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120248251 NCBI-ProteinID:  XP_039112483 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MMSGRRGRRYSYRRRKCVLFRSRRTELQFPVSQVERLLRESCSTQHLSPSTPVFLAGVLQ YLTANILDLAGNEALSNHKMRITPEHLQRALDRNQHLSRLLEWTASSPVRQTPQVKKC NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgatgtctgggaggcgaggccgccgctactcttacagacgtcggaagtgcgttctcttc cgctccaggagaaccgagctgcagttcccagtcagccaagtggagcggcttcttcgagag agttgctccacccaacacctgagcccatccacaccggtcttcctggctggcgttctccag tacctgacggccaacatcctggatctggcgggcaacgaggctctcagtaaccacaagatg cgcatcaccccagaacacctgcagagggcactggacagaaaccagcacctcagccgcctc cttgagtggaccgcctcctctccggtccgtcagacgccccaagttaagaagtgctga

DBGET integrated database retrieval system