Hyaena hyaena (striped hyena): 120248382 Help Entry 120248382         CDS       T07257                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04081   Hormone signaling hhv04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     120248382 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     120248382 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120248382 (GAST) Cytokines and neuropeptides [BR:hhv04052]  Neuropeptides   GPCR binding    120248382 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  120248382 NCBI-ProteinID:  XP_039112649 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVCLLILALALATFSEASWKPHSQLQDVPSGPMASRGLEPHWVDRQGPASHHRRQL GLQGPPQPVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDEHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgtgtgcctgctgatcctggcactggctctggccaccttctctgaa gcttcttggaagccccactcccagctgcaggatgtaccctcgggtccgatggccagtagg ggcctggagccacactgggtggaccggcagggcccagcctctcaccaccgacggcagctg gggctccagggtcccccacaaccggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcatacggatggatggacttcggccgccgcagtgcagaggacggc gacgaacatccctag

DBGET integrated database retrieval system