Hyaena hyaena (striped hyena): 120248450 Help Entry 120248450         CDS       T07257                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04014   Ras signaling pathway hhv04137   Mitophagy - animal hhv04144   Endocytosis hhv04145   Phagosome hhv04148   Efferocytosis hhv04962   Vasopressin-regulated water reabsorption hhv05132   Salmonella infection hhv05146   Amoebiasis hhv05152   Tuberculosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120248450 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120248450 (RAB5C)    04145 Phagosome     120248450 (RAB5C)    04137 Mitophagy - animal     120248450 (RAB5C)    04148 Efferocytosis     120248450 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     120248450 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120248450 (RAB5C)    05152 Tuberculosis     120248450 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     120248450 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120248450 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120248450 (RAB5C)    04031 GTP-binding proteins [BR:hhv04031]     120248450 (RAB5C) Membrane trafficking [BR:hhv04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     120248450 (RAB5C)  Endosome - Lysosome transport     120248450 (RAB5C) Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120248450 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    120248450 (RAB5C)   Exosomal proteins of colorectal cancer cells    120248450 (RAB5C)   Exosomal proteins of bladder cancer cells    120248450 (RAB5C) GTP-binding proteins [BR:hhv04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     120248450 (RAB5C) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  120248450 NCBI-ProteinID:  XP_039112743 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGTPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaacggaccggccgctgggaacaagatctgt caatttaagctggtcctgctgggggagtctgcggtgggcaagtccagcctcgtcctccgc tttgtcaaggggcagttccacgagtaccaggagagcacaattggagcggccttcctcaca cagacggtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaagctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctgcag aggcaggctagccccaacatcgtcatcgcgctcgcagggaacaaggcagacctggccagc aagagagctgtggaattccaggaagcacaagcctatgcggaagacaacagtctgctgttc atggagacatctgcaaagaccgcgatgaacgtgaatgaaattttcatggcgatagctaag aagcttcccaagaacgagccccagaatgcagctggcactccaggccggaaccgaggcgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system