Hyaena hyaena (striped hyena): 120248603 Help Entry 120248603         CDS       T07257                                  Symbol CFL2 Name (RefSeq) cofilin-2 isoform X1   KO K05765   cofilin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04360   Axon guidance hhv04666   Fc gamma R-mediated phagocytosis hhv04810   Regulation of actin cytoskeleton hhv05133   Pertussis hhv05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:hhv00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120248603 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     120248603 (CFL2)   09158 Development and regeneration    04360 Axon guidance     120248603 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120248603 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     120248603 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120248603 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hhv04812]     120248603 (CFL2)    04147 Exosome [BR:hhv04147]     120248603 (CFL2) Membrane trafficking [BR:hhv04131]  Others   Actin-binding proteins    Others     120248603 (CFL2) Cytoskeleton proteins [BR:hhv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      120248603 (CFL2) Exosome [BR:hhv04147]  Exosomal proteins   Proteins found in most exosomes    120248603 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  120248603 NCBI-ProteinID:  XP_039112926 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta agaaaatcttctacgcaagaggagatcaaaaaaagaaagaaagcagttctcttctgtcta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttattttctgggctcctgagagtgcacctttaaaaagcaagatgatttatgctagctct aaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaggtaaatggcttg gatgatataaaggaccgttcaacacttggagagaaactgggaggcaacgtagtagtttca cttgaaggaaaacccttataa

DBGET integrated database retrieval system