Hyaena hyaena (striped hyena): 120248609 Help Entry 120248609         CDS       T07257                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04024   cAMP signaling pathway hhv04062   Chemokine signaling pathway hhv04064   NF-kappa B signaling pathway hhv04210   Apoptosis hhv04380   Osteoclast differentiation hhv04620   Toll-like receptor signaling pathway hhv04621   NOD-like receptor signaling pathway hhv04622   RIG-I-like receptor signaling pathway hhv04623   Cytosolic DNA-sensing pathway hhv04625   C-type lectin receptor signaling pathway hhv04657   IL-17 signaling pathway hhv04658   Th1 and Th2 cell differentiation hhv04659   Th17 cell differentiation hhv04660   T cell receptor signaling pathway hhv04662   B cell receptor signaling pathway hhv04668   TNF signaling pathway hhv04722   Neurotrophin signaling pathway hhv04920   Adipocytokine signaling pathway hhv04926   Relaxin signaling pathway hhv04931   Insulin resistance hhv04936   Alcoholic liver disease hhv05132   Salmonella infection hhv05134   Legionellosis hhv05135   Yersinia infection hhv05140   Leishmaniasis hhv05142   Chagas disease hhv05145   Toxoplasmosis hhv05160   Hepatitis C hhv05161   Hepatitis B hhv05162   Measles hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05166   Human T-cell leukemia virus 1 infection hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05168   Herpes simplex virus 1 infection hhv05169   Epstein-Barr virus infection hhv05170   Human immunodeficiency virus 1 infection hhv05171   Coronavirus disease - COVID-19 hhv05200   Pathways in cancer hhv05203   Viral carcinogenesis hhv05208   Chemical carcinogenesis - reactive oxygen species hhv05215   Prostate cancer hhv05220   Chronic myeloid leukemia hhv05222   Small cell lung cancer hhv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     120248609 (NFKBIA)    04668 TNF signaling pathway     120248609 (NFKBIA)    04024 cAMP signaling pathway     120248609 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120248609 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120248609 (NFKBIA)    04621 NOD-like receptor signaling pathway     120248609 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     120248609 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     120248609 (NFKBIA)    04625 C-type lectin receptor signaling pathway     120248609 (NFKBIA)    04660 T cell receptor signaling pathway     120248609 (NFKBIA)    04658 Th1 and Th2 cell differentiation     120248609 (NFKBIA)    04659 Th17 cell differentiation     120248609 (NFKBIA)    04657 IL-17 signaling pathway     120248609 (NFKBIA)    04662 B cell receptor signaling pathway     120248609 (NFKBIA)    04062 Chemokine signaling pathway     120248609 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     120248609 (NFKBIA)    04926 Relaxin signaling pathway     120248609 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     120248609 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     120248609 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120248609 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     120248609 (NFKBIA)    05203 Viral carcinogenesis     120248609 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120248609 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     120248609 (NFKBIA)    05215 Prostate cancer     120248609 (NFKBIA)    05222 Small cell lung cancer     120248609 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120248609 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     120248609 (NFKBIA)    05161 Hepatitis B     120248609 (NFKBIA)    05160 Hepatitis C     120248609 (NFKBIA)    05171 Coronavirus disease - COVID-19     120248609 (NFKBIA)    05164 Influenza A     120248609 (NFKBIA)    05162 Measles     120248609 (NFKBIA)    05168 Herpes simplex virus 1 infection     120248609 (NFKBIA)    05163 Human cytomegalovirus infection     120248609 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     120248609 (NFKBIA)    05169 Epstein-Barr virus infection     120248609 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     120248609 (NFKBIA)    05135 Yersinia infection     120248609 (NFKBIA)    05134 Legionellosis     120248609 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120248609 (NFKBIA)    05140 Leishmaniasis     120248609 (NFKBIA)    05142 Chagas disease     120248609 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120248609 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120248609 (NFKBIA)    04931 Insulin resistance     120248609 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:hhv03000]     120248609 (NFKBIA)    04131 Membrane trafficking [BR:hhv04131]     120248609 (NFKBIA) Transcription factors [BR:hhv03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     120248609 (NFKBIA) Membrane trafficking [BR:hhv04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     120248609 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  120248609 NCBI-ProteinID:  XP_039112942 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFHPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaccccgccgagcacgcccaggactgggccatggagggtccccgggatgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgggagatccgcctcgagccccaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcattgaccatggaagtggtccgccaagtgaaaggagac ctggcctttctcaatttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctactccatcctgcaggccaccaac tacaatggtcacacgtgtctgcacttagcctctatccacggctacctgggtatcgtggag ctcttggtgtctttgggcgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc ctccaccttgcagtggacctgcagaattctgacctcgtgtcgcttttattgaaatgcgga gctgacgtcaacagagtcacctaccaaggctactccccctaccagctcacctggggccgc ccaagcactcggatacagcagcagctgggccagctgaccttagagaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacggagtcagagttcacagaggacgagctg ccctatgacgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system