Hyaena hyaena (striped hyena): 120248814 Help Entry 120248814         CDS       T07257                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04613   Neutrophil extracellular trap formation hhv05034   Alcoholism hhv05203   Viral carcinogenesis hhv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hhv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120248814  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     120248814   09163 Immune disease    05322 Systemic lupus erythematosus     120248814   09165 Substance dependence    05034 Alcoholism     120248814  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhv03036]     120248814 Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120248814 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  120248814 NCBI-ProteinID:  XP_039113227 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgcggcaagggcgggaagggcctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcacgaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacgcgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctga

DBGET integrated database retrieval system