Hyaena hyaena (striped hyena): 120248842 Help Entry 120248842         CDS       T07257                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04613   Neutrophil extracellular trap formation hhv05034   Alcoholism hhv05202   Transcriptional misregulation in cancer hhv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hhv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120248842  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     120248842   09163 Immune disease    05322 Systemic lupus erythematosus     120248842   09165 Substance dependence    05034 Alcoholism     120248842  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhv03036]     120248842   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120248842 Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120248842 Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120248842 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  120248842 NCBI-ProteinID:  XP_039113269 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MKIARRKQSSRKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRV TIMPKDIQLARRIRGERA NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgaagatagctcgtaggaaacagtcctcgcgcaagtcgacgggcggcaaggccccgcgc aagcagctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaag ccgcaccgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtcc accgagctgctcatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggac ttcaagaccgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgag gcctacctcgtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtc accatcatgcccaaggacatccagctggcgcgccgcattcgcggcgagcgggcgtag

DBGET integrated database retrieval system