Hyaena hyaena (striped hyena): 14842163 Help Entry 14842163          CDS       T07257                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv00190   Oxidative phosphorylation hhv01100   Metabolic pathways hhv04714   Thermogenesis hhv04723   Retrograde endocannabinoid signaling hhv05010   Alzheimer disease hhv05012   Parkinson disease hhv05014   Amyotrophic lateral sclerosis hhv05016   Huntington disease hhv05020   Prion disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05208   Chemical carcinogenesis - reactive oxygen species hhv05415   Diabetic cardiomyopathy Module hhv_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:hhv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     14842163 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     14842163 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     14842163 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     14842163 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     14842163 (ND4L)    05012 Parkinson disease     14842163 (ND4L)    05014 Amyotrophic lateral sclerosis     14842163 (ND4L)    05016 Huntington disease     14842163 (ND4L)    05020 Prion disease     14842163 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     14842163 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     14842163 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hhv03029]     14842163 (ND4L) Enzymes [BR:hhv01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      14842163 (ND4L) Mitochondrial biogenesis [BR:hhv03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     14842163 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  14842163 NCBI-ProteinID:  YP_007625661 UniProt:  H9LSM1 LinkDB All DBs Position MT AA seq 98 aa AA seqDB search MSIVYINIFLAFTVSLLGLLVYRSHLMSSLLCLEGMMLSLFIMMTVVILNNHFTLANMTP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctattgtatatattaatatctttttagctttcactgtatctcttttaggtctccta gtctatcgatcacacctcatatcctcgctactatgcttagagggcatgatgctgtctcta ttcattataataactgtagtaatcctaaataaccacttcacactagccaacatgactcca atcatccttctagtattcgctgcctgcgaagcagccctgggcctgtccctactagtaata gtctctaatacttacggaactgactacgtacaaaatctgaacctcttgcaatgctaa

DBGET integrated database retrieval system