Haemophilus influenzae Hi375: NF38_05430 Help Entry NF38_05430        CDS       T03485                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism hih  Haemophilus influenzae Hi375 Pathway hih03030   DNA replication hih03430   Mismatch repair hih03440   Homologous recombination Brite KEGG Orthology (KO) [BR:hih00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     NF38_05430    03430 Mismatch repair     NF38_05430    03440 Homologous recombination     NF38_05430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hih03032]     NF38_05430    03400 DNA repair and recombination proteins [BR:hih03400]     NF38_05430 Enzymes [BR:hih01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      NF38_05430 DNA replication proteins [BR:hih03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      NF38_05430 DNA repair and recombination proteins [BR:hih03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      NF38_05430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_III_psi Motif Other DBs NCBI-ProteinID:  AIT67653 UniProt:  A0A2R3FZB9 LinkDB All DBs Position 1087069..1087473 Genome browser AA seq 134 aa AA seqDB search MNRRDLLLQEMGISQWELYRPEVLQGSVGISVAENIRFITVSNENISSSPLLADVLLSLN LKKENCLCLNYDQIQHMECKQPIRYWLLSENNDQIDRTLPFCKQAEQVYRSPSWQQFQSN HQAKRALWQQIQQP NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaacagacgcgatcttcttttacaagaaatgggcatttcccagtgggaattatatcgc cccgaggtactgcaaggttcagtaggaattagtgtggcagagaatattcgctttatcact gtttccaatgaaaatatcagtagctcgcctttgttggctgatgtgctgttaagccttaat cttaaaaaagaaaattgtttatgtttgaattacgatcaaatccagcatatggaatgtaag cagcctattcgttactggttactatcagaaaataacgaccaaattgaccgcactttgcca ttttgcaagcaggctgagcaggtttatcgctcgccaagttggcagcaatttcaatctaat catcaagccaaacgagcgttgtggcaacaaattcagcagccttaa

DBGET integrated database retrieval system