Heterobasidion irregulare: HETIRDRAFT_164342 Help Entry HETIRDRAFT_164342 CDS       T03455                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism hir  Heterobasidion irregulare Pathway hir03022   Basal transcription factors hir03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:hir00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     HETIRDRAFT_164342   09124 Replication and repair    03420 Nucleotide excision repair     HETIRDRAFT_164342  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:hir03021]     HETIRDRAFT_164342    03400 DNA repair and recombination proteins [BR:hir03400]     HETIRDRAFT_164342 Transcription machinery [BR:hir03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      HETIRDRAFT_164342 DNA repair and recombination proteins [BR:hir03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      HETIRDRAFT_164342 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 NLS_NINJA_AFP Motif Other DBs NCBI-GeneID:  20667910 NCBI-ProteinID:  XP_009552935 JGI:  Hetan2_164342 UniProt:  W4JR14 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MKAIRGVLFSCDSAVKQILLSMNEKQSFIIEDLDDFHVLIKADEEWRVRKELEAELEKNT YSLE NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaaggctatccgaggcgtccttttcagttgtgactcggcagtaaagcaaattctactt tccatgaacgagaagcagagtttcatcattgaggacttggatgatttccatgttcttatc aaggcagatgaggagtggagggttaggaaggaactcgaagctgagctggagaagaatacg tacagtttagagtga

DBGET integrated database retrieval system