Heterobasidion irregulare: HETIRDRAFT_381789 Help Entry HETIRDRAFT_381789 CDS       T03455                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism hir  Heterobasidion irregulare Pathway hir03020   RNA polymerase hir03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:hir00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     HETIRDRAFT_381789   09124 Replication and repair    03420 Nucleotide excision repair     HETIRDRAFT_381789  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:hir03021]     HETIRDRAFT_381789    03400 DNA repair and recombination proteins [BR:hir03400]     HETIRDRAFT_381789 Transcription machinery [BR:hir03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      HETIRDRAFT_381789   RNA polymerase III system    RNA polymerase III      HETIRDRAFT_381789   RNA polymerase I system    RNA polymerase I      HETIRDRAFT_381789 DNA repair and recombination proteins [BR:hir03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       HETIRDRAFT_381789 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 DUF7130 DmmA-like_C Zn_ribbon_10 DUF7129 HypA zf_Tbcl_2 DZR MCM_OB DZR_2 zf-C3HC DUF5816 Zn_ribbon_8 Zn_Ribbon_TF Cas12f1-like_TNB Zn_ribbon_LysW DUF7577 Motif Other DBs NCBI-GeneID:  20672088 NCBI-ProteinID:  XP_009543995 JGI:  Hetan2_381789 UniProt:  W4KH04 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MNQPGTQNTNGNGTGTGFMPAPRQEMEYLCADCGAKNEIKSREPIRCRECGHRIMYKKRT KR NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgaatcagcccggcacacaaaacacgaatgggaatgggacagggaccggcttcatgcct gctcctagacaggagatggagtacctgtgtgctgactgcggcgcgaagaacgagatcaag tcgagagaacccatccggtgtagagagtgcgggcaccgaatcatgtacaagaaaaggacc aagcgg

DBGET integrated database retrieval system