Heterobasidion irregulare: HETIRDRAFT_450617 Help Entry HETIRDRAFT_450617 CDS       T03455                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism hir  Heterobasidion irregulare Pathway hir03060   Protein export hir04141   Protein processing in endoplasmic reticulum hir04145   Phagosome Brite KEGG Orthology (KO) [BR:hir00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     HETIRDRAFT_450617    04141 Protein processing in endoplasmic reticulum     HETIRDRAFT_450617  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     HETIRDRAFT_450617  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hir04131]     HETIRDRAFT_450617   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:hir02044]     HETIRDRAFT_450617 Membrane trafficking [BR:hir04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     HETIRDRAFT_450617 Secretion system [BR:hir02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    HETIRDRAFT_450617 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  20676063 NCBI-ProteinID:  XP_009545201 JGI:  Hetan2_450617 UniProt:  W4KAN9 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MSSQSDSDSARPATPRTAGANAVAKPPGAQIRRRAGASQVSKPNSSRAAGAGGSSNTMLK LYTDDSPGLRVDPFIVLVLSLSFIASIFFLHISAKIIRAFTK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgcagtctgactctgactctgcccgccccgcaaccccccgcaccgccggcgca aacgcagttgcgaaaccaccaggtgcacagattcgtcgtcgcgctggcgcctcgcaagtt tcaaagccaaactcatcgcgtgcagcgggtgccggcgggtcttccaacactatgctcaag ctctacaccgacgactcaccaggcctccgagtagacccattcatcgtccttgtcctctcg ctgtccttcatcgcatccatcttcttcctccacatctccgcgaagattatccgtgccttc acgaagtaa

DBGET integrated database retrieval system