Heterobasidion irregulare: HETIRDRAFT_454609 Help Entry HETIRDRAFT_454609 CDS       T03455                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism hir  Heterobasidion irregulare Pathway hir00510   N-Glycan biosynthesis hir00513   Various types of N-glycan biosynthesis hir01100   Metabolic pathways hir04141   Protein processing in endoplasmic reticulum Module hir_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:hir00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     HETIRDRAFT_454609    00513 Various types of N-glycan biosynthesis     HETIRDRAFT_454609  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     HETIRDRAFT_454609 SSDB OrthologParalogGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  20676535 NCBI-ProteinID:  XP_009550796 JGI:  Hetan2_454609 UniProt:  W4JUP3 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MITHDTLYSLANSLGALAMITVVAYHFVAVNAKYLAKNGAGYIRTIDTFSGSYDTKFFYK DGDPVRIRGIECLQITEV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgatcacgcacgataccctgtactcgctcgccaactctctcggcgcgctggcgatgatc accgtcgtcgcttaccacttcgtcgcggtgaacgcgaaatatttggcgaagaacggggcc gggtacatacgaacgatcgacacgttcagcgggagctatgacactaaattcttttataaa gatggagatcctgtccgcattcggggtatcgaatgcttgcagattactgaagtgtga

DBGET integrated database retrieval system