Hermetia illucens (black soldier fly): 119646660 Help Entry 119646660         CDS       T08287                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism his  Hermetia illucens (black soldier fly) Pathway his04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:his00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119646660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:his04121]     119646660    03400 DNA repair and recombination proteins [BR:his03400]     119646660 Ubiquitin system [BR:his04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      119646660    Cul5 complex      119646660 DNA repair and recombination proteins [BR:his03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      119646660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  119646660 NCBI-ProteinID:  XP_037903118 LinkDB All DBs Position 1:44757295..44766541 Genome browser AA seq 118 aa AA seqDB search MDVFLVIRRKKSTIFTDAKENTTVTELKKIIEGILKIKPRDQMLFNKENLVMEEEKLLQD YGITTITAKPQTPAQLGLAIRMENGEFEQLEITPYSSPPELPDVMKNHEAANGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttttagtaatacgacgcaagaaatcaactattttcaccgatgccaaggag aacactaccgtcacggaactgaagaaaataattgaaggtattttaaagattaaacctagg gaccaaatgctctttaataaagaaaatttggtaatggaagaagaaaaacttctgcaggat tatggtatcacaacaattacagccaaacctcagacaccagcgcaactgggcctagctata cgaatggaaaatggagaatttgaacaactcgaaatcacaccatactcatcgcctccagaa ttaccagacgttatgaaaaatcatgaagcagcgaatggtcaagaacaagtggcttag

DBGET integrated database retrieval system