Hermetia illucens (black soldier fly): 119660877 Help Entry 119660877         CDS       T08287                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism his  Hermetia illucens (black soldier fly) Pathway his04814   Motor proteins Brite KEGG Orthology (KO) [BR:his00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     119660877  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:his03037]     119660877    04812 Cytoskeleton proteins [BR:his04812]     119660877 Cilium and associated proteins [BR:his03037]  Motile cilia and associated proteins   Dynein arm    119660877 Cytoskeleton proteins [BR:his04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119660877 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light YcxB Motif Other DBs NCBI-GeneID:  119660877 NCBI-ProteinID:  XP_037925721 LinkDB All DBs Position 1:102615828..102624512 Genome browser AA seq 106 aa AA seqDB search MAEEGGKPEGEGDKKVVHVYPLVKHSDMVEEMRTEAIELSITACEKYAQNYELAARTIKE TMDKKFGTYWHVVVGEGFGFEVSYETKNILYLFFGGNLAIVVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggccgaggaagggggcaaacccgaaggagagggtgataagaaagttgtgcacgtgtat ccactagttaagcattctgatatggtcgaggaaatgcgaacggaagcgattgaattgagt atcacagcctgtgagaaatatgcacagaattatgagcttgctgcacgcacaatcaaagaa actatggataagaagttcggcacctactggcatgtagtggtgggcgaaggattcggcttt gaagtgtcgtacgaaacgaaaaacatcttatatctatttttcggaggcaatttagcgata gtcgtgtggaagtgctcgtaa

DBGET integrated database retrieval system