Haemophilus influenzae R2866 (nontypeable): R2866_1600
Help
Entry
R2866_1600 CDS
T01981
Symbol
rpL18
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
hiz
Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
hiz00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
R2866_1600 (rpL18)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
hiz03011
]
R2866_1600 (rpL18)
Ribosome [BR:
hiz03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
R2866_1600 (rpL18)
Bacteria
R2866_1600 (rpL18)
Archaea
R2866_1600 (rpL18)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
TM1506
Motif
Other DBs
NCBI-ProteinID:
ADO81529
LinkDB
All DBs
Position
complement(1641742..1642095)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKSARIRRAARARHMMREQGVTRLVIHRTPRHIYAQVIAPNGSEVLAAASTVEKAIRE
QVKYTGNKDAAAAVGKAVAERALAKGVQAVAFDRSGFKYHGRVQTLADAAREAGLQF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaatcagctcgtatccgtcgtgcagctcgtgcacgtcatatgatgagagag
caaggtgtaactcgtttagttattcaccgcactccacgtcatatttatgcacaagttatt
gcaccaaacggttcagaagtgcttgccgctgcttcaactgttgagaaagcaattcgtgag
caagtaaaatacaccggtaataaagatgctgctgcagcagtaggtaaagctgttgcagaa
cgcgcattagcaaaaggcgttcaagctgttgcttttgatcgttccggttttaaatatcat
ggacgtgtccaaactttagcggacgctgcacgtgaagctggtctacagttctaa
DBGET
integrated database retrieval system