KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1600
Entry
R2866_1600        CDS       T01981                                 
Symbol
rpL18
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    R2866_1600 (rpL18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hiz03011]
    R2866_1600 (rpL18)
Ribosome [BR:hiz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    R2866_1600 (rpL18)
  Bacteria
    R2866_1600 (rpL18)
  Archaea
    R2866_1600 (rpL18)
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e TM1506
Other DBs
NCBI-ProteinID: ADO81529
LinkDB
Position
complement(1641742..1642095)
AA seq 117 aa
MDKKSARIRRAARARHMMREQGVTRLVIHRTPRHIYAQVIAPNGSEVLAAASTVEKAIRE
QVKYTGNKDAAAAVGKAVAERALAKGVQAVAFDRSGFKYHGRVQTLADAAREAGLQF
NT seq 354 nt   +upstreamnt  +downstreamnt
atggataagaaatcagctcgtatccgtcgtgcagctcgtgcacgtcatatgatgagagag
caaggtgtaactcgtttagttattcaccgcactccacgtcatatttatgcacaagttatt
gcaccaaacggttcagaagtgcttgccgctgcttcaactgttgagaaagcaattcgtgag
caagtaaaatacaccggtaataaagatgctgctgcagcagtaggtaaagctgttgcagaa
cgcgcattagcaaaaggcgttcaagctgttgcttttgatcgttccggttttaaatatcat
ggacgtgtccaaactttagcggacgctgcacgtgaagctggtctacagttctaa

DBGET integrated database retrieval system