Halioglobus japonicus: BST95_12990 Help Entry BST95_12990       CDS       T04687                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hja  Halioglobus japonicus Pathway hja01100   Metabolic pathways hja01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hja00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BST95_12990    00074 Mycolic acid biosynthesis     BST95_12990   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BST95_12990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AQA19020 UniProt:  A0AAP8SPU8 LinkDB All DBs Position complement(2753464..2753700) Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEEVQTEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVKLAIDYINENLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgcgttaagaagatcgttgcagagcaacttggcgtgaaagaa gaagaagttcaaaccgaggcttcatttgtagaagatctgggcgcggactcgctggacacc gtcgaactggtgatggcgctggaagaggaattcgaaactgaaattcccgacgaggaagcc gaaaaaattaccactgtaaagctggcgattgattacatcaacgaaaacctcgcctga

DBGET integrated database retrieval system