Halalkalicoccus jeotgali: HacjB3_04465 Help Entry HacjB3_04465      CDS       T01271                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hje  Halalkalicoccus jeotgali Pathway hje03010   Ribosome Brite KEGG Orthology (KO) [BR:hje00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HacjB3_04465   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HacjB3_04465  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hje03011]     HacjB3_04465    04121 Ubiquitin system [BR:hje04121]     HacjB3_04465   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hje04147]     HacjB3_04465 Ribosome [BR:hje03011]  Ribosomal proteins   Eukaryotes    Small subunit     HacjB3_04465   Archaea     HacjB3_04465 Ubiquitin system [BR:hje04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HacjB3_04465 Exosome [BR:hje04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HacjB3_04465   Exosomal proteins of colorectal cancer cells    HacjB3_04465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 zf-C2H2_FBX41 DUF5817 Motif Other DBs NCBI-ProteinID:  ADJ14284 UniProt:  D8J8U9 LinkDB All DBs Position complement(872331..872465) Genome browser AA seq 44 aa AA seqDB search MARHEIYGEDGSADREQCPRCGDTYLGDYGDRMHCGRCSYTEWQ NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgccacgagatctacggcgaggacgggtcggccgatcgcgagcagtgtccccgc tgtggcgatacgtacctcggcgactacggcgaccgcatgcactgtgggcgctgtagctac accgagtggcagtag

DBGET integrated database retrieval system