Haematospirillum jordaniae: AY555_00885
Help
Entry
AY555_00885 CDS
T04366
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
hjo
Haematospirillum jordaniae
Pathway
hjo03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
hjo00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
AY555_00885
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
hjo03011
]
AY555_00885
Ribosome [BR:
hjo03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
AY555_00885
Bacteria
AY555_00885
Archaea
AY555_00885
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
AMW33967
UniProt:
A0A143DB61
LinkDB
All DBs
Position
complement(179209..179571)
Genome browser
AA seq
120 aa
AA seq
DB search
MAKNLSLFERRRDRVRYQLRKKAAGRLRLSVFRSSKHIYAQVIDDAKGCTLVAASTLDKG
LREHLKTGADTVAAAAVGKLVAERALEAGVKDVVFDRGGYVFHGRVKALADAAREGGLSF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atggcgaaaaatttgtctcttttcgagcgccgccgcgatcgcgtgcggtatcagctcagg
aagaaggccgccgggcgtttgcgcctttcggttttccgctcatccaagcatatctatgct
caagttattgacgatgccaagggatgtacccttgttgctgcctcgaccttggacaaagga
ttgcgtgagcatttgaaaaccggtgccgatacagtagctgccgctgctgtgggcaaactg
gtggccgagcgggctcttgaagccggcgttaaagatgtcgtgttcgatcgtgggggctat
gtgttccacggccgggtgaaagctctggcggatgcggcgcgtgaaggcggactttcgttc
taa
DBGET
integrated database retrieval system