Natrinema thermotolerans: DVR14_14460 Help Entry DVR14_14460       CDS       T05948                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hjt  Natrinema thermotolerans Pathway hjt03010   Ribosome Brite KEGG Orthology (KO) [BR:hjt00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DVR14_14460   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DVR14_14460  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hjt03011]     DVR14_14460    04121 Ubiquitin system [BR:hjt04121]     DVR14_14460 Ribosome [BR:hjt03011]  Ribosomal proteins   Eukaryotes    Large subunit     DVR14_14460   Archaea     DVR14_14460 Ubiquitin system [BR:hjt04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DVR14_14460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 zf-CHY DZR Ribosomal_L37e Zn_ribbon_3 Zn_ribbon_LapB HypA Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  QCC59763 LinkDB All DBs Position 2529929..2530078 Genome browser AA seq 49 aa AA seqDB search MASFDAAEKRTLEKMICMRCNARNSKRAQRCRKCGYEKLRPKAKEPRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccagtttcgacgccgctgagaaacggacgctcgagaagatgatctgcatgcgctgt aacgctcgcaactccaagcgagcccagcgctgtcgcaagtgtggctacgagaagcttcgc cccaaggcgaaggaaccgcgcgcggcataa

DBGET integrated database retrieval system