Halosquirtibacter laminarini: K4L44_08910 Help Entry K4L44_08910       CDS       T10546                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hlam  Halosquirtibacter laminarini Pathway hlam00020   Citrate cycle (TCA cycle) hlam00720   Other carbon fixation pathways hlam01100   Metabolic pathways hlam01110   Biosynthesis of secondary metabolites hlam01120   Microbial metabolism in diverse environments hlam01200   Carbon metabolism hlam01210   2-Oxocarboxylic acid metabolism Module hlam_M00009   Citrate cycle (TCA cycle, Krebs cycle) hlam_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:hlam00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K4L44_08910   09102 Energy metabolism    00720 Other carbon fixation pathways     K4L44_08910 Enzymes [BR:hlam01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K4L44_08910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_2 Fer4_6 Fer4_10 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_15 Fer4_3 Fer4_17 Fer4_8 Fer4_13 Motif Other DBs NCBI-ProteinID:  QZE12709 LinkDB All DBs Position 2250836..2251063 Genome browser AA seq 75 aa AA seqDB search MAKIKGAVVVDTEECKGCNLCVVACPTQTLSLNRNVNGKGYNFSYMENPDSCIGCSNCSL VCPDSCITVYRVKTA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctaaaataaaaggagctgtagtggtggatacagaagagtgcaaaggatgcaacctt tgtgtggtagcttgtccgacacaaacactaagcctaaaccgcaacgtcaatggcaaaggc tacaatttctcctatatggagaacccagatagttgcataggatgttctaattgttcgttg gtgtgtccggatagttgtattacagtgtacagagtaaaaactgcttaa

DBGET integrated database retrieval system