Natronobacterium lacisalsi: CHINAEXTREME06805 Help Entry CHINAEXTREME06805 CDS       T04669                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hlc  Natronobacterium lacisalsi Pathway hlc03010   Ribosome Brite KEGG Orthology (KO) [BR:hlc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CHINAEXTREME06805   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CHINAEXTREME06805  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hlc03011]     CHINAEXTREME06805    04121 Ubiquitin system [BR:hlc04121]     CHINAEXTREME06805 Ribosome [BR:hlc03011]  Ribosomal proteins   Eukaryotes    Large subunit     CHINAEXTREME06805   Archaea     CHINAEXTREME06805 Ubiquitin system [BR:hlc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CHINAEXTREME06805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-CHY DZR_2 DHHC Motif Other DBs NCBI-ProteinID:  APW97497 UniProt:  M0LU86 LinkDB All DBs Position 1440244..1440393 Genome browser AA seq 49 aa AA seqDB search MPSFDAAENRSLEKMICMRCNARNPKRADSCRKCGYGNLRPKAKEPRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgccaagcttcgacgccgccgagaaccggtcgctcgagaagatgatctgcatgcgctgt aacgcccgcaacccgaagcgagccgactcttgccggaagtgtggctacgggaacctccgc cccaaggcgaaagaaccccgcgcagcgtaa

DBGET integrated database retrieval system