Natronobacterium lacisalsi: CHINAEXTREME07795 Help Entry CHINAEXTREME07795 CDS       T04669                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hlc  Natronobacterium lacisalsi Pathway hlc03010   Ribosome Brite KEGG Orthology (KO) [BR:hlc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CHINAEXTREME07795   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CHINAEXTREME07795  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hlc03011]     CHINAEXTREME07795    04121 Ubiquitin system [BR:hlc04121]     CHINAEXTREME07795   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hlc04147]     CHINAEXTREME07795 Ribosome [BR:hlc03011]  Ribosomal proteins   Eukaryotes    Small subunit     CHINAEXTREME07795   Archaea     CHINAEXTREME07795 Ubiquitin system [BR:hlc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CHINAEXTREME07795 Exosome [BR:hlc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CHINAEXTREME07795   Exosomal proteins of colorectal cancer cells    CHINAEXTREME07795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 DUF7479 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  APW97680 UniProt:  M0LXV8 LinkDB All DBs Position complement(1636297..1636431) Genome browser AA seq 44 aa AA seqDB search MARYDHYGDDGSTEGEQCPRCGDVFLADHGDRKHCGKCSYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacgctacgaccactacggcgacgacgggagcaccgagggcgaacagtgtccccgc tgtggcgacgtcttcctcgccgaccacggcgaccgcaagcactgcgggaagtgcagctac accgagtgggagtag

DBGET integrated database retrieval system