Haliaeetus leucocephalus (bald eagle): 104829565 Help Entry 104829565         CDS       T08630                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism hle  Haliaeetus leucocephalus (bald eagle) Pathway hle04010   MAPK signaling pathway hle04068   FoxO signaling pathway hle04081   Hormone signaling hle04114   Oocyte meiosis hle04140   Autophagy - animal hle04150   mTOR signaling pathway hle04810   Regulation of actin cytoskeleton hle04910   Insulin signaling pathway hle04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:hle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104829565 (INS)    04068 FoxO signaling pathway     104829565 (INS)    04150 mTOR signaling pathway     104829565 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104829565 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104829565 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104829565 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104829565 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104829565 (INS)    04914 Progesterone-mediated oocyte maturation     104829565 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hle04052]     104829565 (INS) Cytokines and neuropeptides [BR:hle04052]  Neuropeptides   Unclassified    104829565 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104829565 NCBI-ProteinID:  XP_010562197 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSIPGTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVSGPLHGEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcactgcctctcctggcccttctcgctctttccatccctggg accagccatgcggctgccaaccagcacctctgcggctcccacttggtggaggctctctac ctggtgtgcggagagcggggtttcttctactcccccaaagcccgacgggacattgagcag cctctagtgagcggtcccttgcacggtgaggtaggagagctgcccttccagcaggaagag tttgagaaagtgaagagagggatcgtcgagcaatgctgccacaacacttgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system