Haliaeetus leucocephalus (bald eagle): 104835011 Help Entry 104835011         CDS       T08630                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism hle  Haliaeetus leucocephalus (bald eagle) Pathway hle04081   Hormone signaling hle04144   Endocytosis hle04150   mTOR signaling pathway hle04270   Vascular smooth muscle contraction hle04310   Wnt signaling pathway hle04350   TGF-beta signaling pathway hle04510   Focal adhesion hle04520   Adherens junction hle04530   Tight junction hle04621   NOD-like receptor signaling pathway hle04625   C-type lectin receptor signaling pathway hle04810   Regulation of actin cytoskeleton hle05100   Bacterial invasion of epithelial cells hle05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hle00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104835011 (RHOA)    04350 TGF-beta signaling pathway     104835011 (RHOA)    04150 mTOR signaling pathway     104835011 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     104835011 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104835011 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104835011 (RHOA)    04520 Adherens junction     104835011 (RHOA)    04530 Tight junction     104835011 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104835011 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104835011 (RHOA)    04625 C-type lectin receptor signaling pathway     104835011 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     104835011 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104835011 (RHOA)    05100 Bacterial invasion of epithelial cells     104835011 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hle04131]     104835011 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hle04147]     104835011 (RHOA)    04031 GTP-binding proteins [BR:hle04031]     104835011 (RHOA) Membrane trafficking [BR:hle04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     104835011 (RHOA) Exosome [BR:hle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104835011 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    104835011 (RHOA)   Exosomal proteins of colorectal cancer cells    104835011 (RHOA)   Exosomal proteins of bladder cancer cells    104835011 (RHOA) GTP-binding proteins [BR:hle04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     104835011 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  104835011 NCBI-ProteinID:  XP_010571091 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttgtcttataa

DBGET integrated database retrieval system