Haliaeetus leucocephalus (bald eagle): 104835416 Help Entry 104835416         CDS       T08630                                  Symbol CD24 Name (RefSeq) signal transducer CD24   KO K06469   CD24 antigen Organism hle  Haliaeetus leucocephalus (bald eagle) Pathway hle04148   Efferocytosis Brite KEGG Orthology (KO) [BR:hle00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     104835416 (CD24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:hle04090]     104835416 (CD24)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hle00537]     104835416 (CD24) CD molecules [BR:hle04090]  Proteins   104835416 (CD24) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hle00537]  Antigens   104835416 (CD24) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD24 Motif Other DBs NCBI-GeneID:  104835416 NCBI-ProteinID:  XP_010571697 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search MGTALAARLGLGLLLLALLLPRQIYCDSNGTSPTPSNNSSASSTSLSVVTSSVNNTTPQG HGNSLHSTTSLLFILLVSLLYLCC NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggggacggcgctggcggcgcggctcggcctggggctcttgctcctggccctcctccta cccaggcagatctactgcgattccaatggaacaagtccaacaccttcaaacaattcttca gcaagttccacttctctgtcagttgtcacaagttcagtgaacaatacgacccctcaggga catggaaattcccttcactcaaccacaagtcttcttttcattctcttagtttctcttctg tatctttgctgttaa

DBGET integrated database retrieval system