Haliaeetus leucocephalus (bald eagle): 104838685 Help Entry 104838685         CDS       T08630                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism hle  Haliaeetus leucocephalus (bald eagle) Pathway hle04010   MAPK signaling pathway hle04012   ErbB signaling pathway hle04068   FoxO signaling pathway hle04137   Mitophagy - animal hle04140   Autophagy - animal hle04150   mTOR signaling pathway hle04210   Apoptosis hle04218   Cellular senescence hle04370   VEGF signaling pathway hle04371   Apelin signaling pathway hle04540   Gap junction hle04625   C-type lectin receptor signaling pathway hle04810   Regulation of actin cytoskeleton hle04910   Insulin signaling pathway hle04912   GnRH signaling pathway hle04916   Melanogenesis Brite KEGG Orthology (KO) [BR:hle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104838685 (NRAS)    04012 ErbB signaling pathway     104838685 (NRAS)    04370 VEGF signaling pathway     104838685 (NRAS)    04371 Apelin signaling pathway     104838685 (NRAS)    04068 FoxO signaling pathway     104838685 (NRAS)    04150 mTOR signaling pathway     104838685 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104838685 (NRAS)    04137 Mitophagy - animal     104838685 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104838685 (NRAS)    04218 Cellular senescence     104838685 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104838685 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104838685 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104838685 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104838685 (NRAS)    04912 GnRH signaling pathway     104838685 (NRAS)    04916 Melanogenesis     104838685 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hle04131]     104838685 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hle04147]     104838685 (NRAS)    04031 GTP-binding proteins [BR:hle04031]     104838685 (NRAS) Membrane trafficking [BR:hle04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104838685 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104838685 (NRAS) Exosome [BR:hle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104838685 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104838685 (NRAS)   Exosomal proteins of breast cancer cells    104838685 (NRAS)   Exosomal proteins of colorectal cancer cells    104838685 (NRAS) GTP-binding proteins [BR:hle04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104838685 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  104838685 NCBI-ProteinID:  XP_010576865 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtcggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccactatcgaggattcgtat agaaagcaggttgttatcgatggagagacgtgtttgttagacattctggacactgcggga caggaagagtatagtgccatgcgtgatcagtacatgagaactggggaaggattcctctgt gtttttgccattaacaacagtaaatcgtttgctgatattaacctttacagagaacagatc aagagagtgaaagattcggatgatgtgccgatggtgctagttgggaacaagtgtgacttg cccacgagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatcccc ttcatagagacatctgctaaaacgagacagggtgtggaagatgctttttacacactggtg agagagatccggcagtatcggatgaaaaaactcaacagcaatgaagatgggaatcaaggc tgcatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system