Haliaeetus leucocephalus (bald eagle): 104842413 Help Entry 104842413         CDS       T08630                                  Name (RefSeq) glutathione S-transferase 2-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism hle  Haliaeetus leucocephalus (bald eagle) Pathway hle00480   Glutathione metabolism hle00980   Metabolism of xenobiotics by cytochrome P450 hle00982   Drug metabolism - cytochrome P450 hle00983   Drug metabolism - other enzymes hle01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:hle00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     104842413   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     104842413    00982 Drug metabolism - cytochrome P450     104842413    00983 Drug metabolism - other enzymes     104842413  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hle02000]     104842413 Enzymes [BR:hle01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      104842413 Transporters [BR:hle02000]  Other transporters   Pores ion channels [TC:1]    104842413 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_C GST_C_3 GST_N_3 Motif Other DBs NCBI-GeneID:  104842413 NCBI-ProteinID:  XP_010583044 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MPSACCWSTRRPPTRRGSTAPAQLPYLIDGPIKLTQSNAILRYIARKHNMGGETEEEMLR VDMLENELMDLRMRFVQLCYNPDFEKLKPAYLEQLPGKLRDLSRFLGSRPWFAGEKALEK ISAYMRSGRFMRTPIFWRTAQWSNTKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgccatccgcttgctgctggagtacacggagaccccctaccaggagaggcagtaccgcc ccggcccagctaccctatctcatcgatggtcccatcaagctgacgcagagcaatgccatc ctgcgctacatcgcccgcaagcacaacatgggaggtgagacggaggaggagatgctgcgt gtggacatgctggagaacgagctcatggatttgcgtatgagatttgtccagctgtgctac aaccccgactttgagaagctgaagccggcgtacctggagcagctgccggggaagctgcgg gatctgtcacggttcctgggctcccggccgtggtttgcaggggagaaggcgctggagaag atctccgcctacatgcggtcggggcgcttcatgaggacccccattttctggcgcacggct caatggtccaacaccaaggactga

DBGET integrated database retrieval system