Halobellus limi: DV707_14140 Help Entry DV707_14140       CDS       T05944                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hlm  Halobellus limi Pathway hlm03010   Ribosome Brite KEGG Orthology (KO) [BR:hlm00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DV707_14140   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DV707_14140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hlm03011]     DV707_14140    04121 Ubiquitin system [BR:hlm04121]     DV707_14140 Ribosome [BR:hlm03011]  Ribosomal proteins   Eukaryotes    Large subunit     DV707_14140   Archaea     DV707_14140 Ubiquitin system [BR:hlm04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DV707_14140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 DHHC Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  QCC48706 UniProt:  A0A1H6CPD8 LinkDB All DBs Position complement(2863660..2863809) Genome browser AA seq 49 aa AA seqDB search MAKNEAAVKRMLEKQICMRCNARNPQRADACRKCGYKNLRPKSKERRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccaagaacgaagctgcggtgaaacggatgctggagaagcagatctgtatgcgctgt aacgcccgcaacccccagcgcgccgacgcgtgccgcaagtgcggctacaagaaccttcga cccaagtcgaaggaacgccgcgccgcgtaa

DBGET integrated database retrieval system