Haloferax volcanii SVX82: SVXHx_0394 Help Entry SVXHx_0394        CDS       T08885                                  Symbol rpl40a Name (GenBank) Ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hln  Haloferax volcanii SVX82 Pathway hln03010   Ribosome Brite KEGG Orthology (KO) [BR:hln00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SVXHx_0394 (rpl40a)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SVXHx_0394 (rpl40a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hln03011]     SVXHx_0394 (rpl40a)    04121 Ubiquitin system [BR:hln04121]     SVXHx_0394 (rpl40a) Ribosome [BR:hln03011]  Ribosomal proteins   Eukaryotes    Large subunit     SVXHx_0394 (rpl40a)   Archaea     SVXHx_0394 (rpl40a) Ubiquitin system [BR:hln04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SVXHx_0394 (rpl40a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 Zn_ribbon_RPAB4 Ribosomal_L37e DHHC DUF6395 Motif Other DBs NCBI-ProteinID:  WEL24723 LinkDB All DBs Position 369952..370098 Genome browser AA seq 48 aa AA seqDB search MASDAATKRTLEKQICMRCNARNPQKAKQCRKCGYKHLRPKSKERRAA NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggctagtgacgctgcgacgaagcggacgctcgagaagcagatttgcatgcggtgcaac gcgcgcaacccccagaaggcaaagcagtgccgcaagtgcggttacaagcaccttcgaccc aagtcgaaggaacgccgcgccgcgtaa

DBGET integrated database retrieval system