Haloferax volcanii SVX82: SVXHx_2043 Help Entry SVXHx_2043        CDS       T08885                                  Symbol pop4 Name (GenBank) RNase P/RNase MRP subunit p29   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism hln  Haloferax volcanii SVX82 Pathway hln03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:hln00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     SVXHx_2043 (pop4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:hln03009]     SVXHx_2043 (pop4)    03016 Transfer RNA biogenesis [BR:hln03016]     SVXHx_2043 (pop4)    03029 Mitochondrial biogenesis [BR:hln03029]     SVXHx_2043 (pop4) Enzymes [BR:hln01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      SVXHx_2043 (pop4) Ribosome biogenesis [BR:hln03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      SVXHx_2043 (pop4) Transfer RNA biogenesis [BR:hln03016]  Eukaryotic type   5'processing factors    Ribonucrease P     SVXHx_2043 (pop4) Mitochondrial biogenesis [BR:hln03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     SVXHx_2043 (pop4) SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 Motif Other DBs NCBI-ProteinID:  WEL26335 LinkDB All DBs Position 1915094..1915525 Genome browser AA seq 143 aa AA seqDB search MPLTPETLTRHELNGLHVEVVDAANPDLVGIAGRIVVETMHTFMVDDGSRVRQVPKRGAT FEFAIPRTDEAADAAKASGTASKLRSDTTGGFDASQSDRLADSSSAASPSGNCEGVAYVT VDGAQLLSRPALRTETTGDSKWR NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgccactgacacccgagaccctcacgcgacacgaactcaacggcctccacgtggaggtc gtcgacgcggcgaaccccgacctcgtcggaatagccggtcgcatcgtcgtcgagacgatg cacacgttcatggtcgacgacgggtctcgggtgcggcaggtgccaaagcgaggggcgacc ttcgaatttgcgattccgcgtacagatgaagccgccgacgctgcgaaggcgtcggggacc gcgtccaaacttcggtcggatactactggcggatttgatgccagtcagtctgatcggctc gccgactcatcatcggcggcttccccctcggggaattgcgagggcgtggcctacgttacg gtggatggcgcacaactgctctcacgacccgccctgcgcaccgaaactactggtgactcg aaatggcgatag

DBGET integrated database retrieval system