Natrinema longum: J0X27_13665 Help Entry J0X27_13665       CDS       T07116                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hlo  Natrinema longum Pathway hlo03010   Ribosome Brite KEGG Orthology (KO) [BR:hlo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     J0X27_13665   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     J0X27_13665  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hlo03011]     J0X27_13665    04121 Ubiquitin system [BR:hlo04121]     J0X27_13665   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hlo04147]     J0X27_13665 Ribosome [BR:hlo03011]  Ribosomal proteins   Eukaryotes    Small subunit     J0X27_13665   Archaea     J0X27_13665 Ubiquitin system [BR:hlo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    J0X27_13665 Exosome [BR:hlo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    J0X27_13665   Exosomal proteins of colorectal cancer cells    J0X27_13665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 Ribosomal_L37e DZR_2 Motif Other DBs NCBI-ProteinID:  QSW84489 UniProt:  A0A8A2U6N8 LinkDB All DBs Position complement(2769481..2769615) Genome browser AA seq 44 aa AA seqDB search MARYDLYGDDGSTEGELCPRCGDVFLANHGDRKHCGKCSYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgctacgacctctacggcgacgacggctccaccgagggcgaactctgcccccgc tgtggcgacgtcttcctcgccaaccacggcgaccgcaagcactgcgggaagtgcagttac accgagtgggagtaa

DBGET integrated database retrieval system