Halobacterium litoreum: LT972_01220 Help Entry LT972_01220       CDS       T07867                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hlu  Halobacterium litoreum Pathway hlu03010   Ribosome Brite KEGG Orthology (KO) [BR:hlu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     LT972_01220   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     LT972_01220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hlu03011]     LT972_01220    04121 Ubiquitin system [BR:hlu04121]     LT972_01220   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hlu04147]     LT972_01220 Ribosome [BR:hlu03011]  Ribosomal proteins   Eukaryotes    Small subunit     LT972_01220   Archaea     LT972_01220 Ubiquitin system [BR:hlu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    LT972_01220 Exosome [BR:hlu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LT972_01220   Exosomal proteins of colorectal cancer cells    LT972_01220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_Ribbon_TF Zn_ribbon_RPB9 Ribosomal_L37e Zn_ribbon_3 Cas12f1-like_TNB zf-C2H2_FBX41 DUF7575 DUF7479 HypA zf_UBZ DUF5817 zf-C2H2_ZN142 Motif Other DBs NCBI-ProteinID:  UHH13631 LinkDB All DBs Position 222696..222830 Genome browser AA seq 44 aa AA seqDB search MPRGDYYEDDGSTEKEQCPRCGDTFLADHGDRQHCGKCGYTEWN NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccccgaggcgactactacgaggacgacgggtccacggagaaagagcagtgtccgcgc tgtggcgacacgttcctcgcggaccacggtgaccgccagcactgcgggaagtgcggctac accgagtggaactga

DBGET integrated database retrieval system